{"product_id":"proteintech-98203-1-rr","title":"Proteintech, 98203-1-RR, Anti-Human IL-4RA\/CD124 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe IL-4RA\/CD124 (98203-1-RR) by Proteintech is a Recombinant antibody targeting IL-4RA\/CD124 in FC applications with reactivity to human samples\n98203-1-RR targets IL-4RA\/CD124 in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: human PBMCs\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL-4 receptor alpha chain (IL-4RA), also known as CD124, is a transmembrane glycoprotein expressed on a wide variety of hematopoietic and non-hematopoietic cells. It is a receptor for both IL-4 and IL-13. IL-4RA can complex with the common gamma chain (IL-2R gamma or CD132) and utilizes JAK1 and JAK2 for signal transduction, while complexes of IL-4RA with IL-13RA1 subunit mediate signals via JAK2 and Tyk2. The IL-4 response is involved in promoting Th2 differentiation. The IL-4\/IL-13 responses are involved in regulating IgE production and chemokine and mucus production at sites of allergic inflammation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1684 Product name: Recombinant Human IL-4 R alpha\/CD124 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 26-232 aa of NM_000418.4 Sequence: MKVLQEPTCVSDYMSISTCEWKMNGPTNCSTELRLLYQLVFLLSEAHTCIPENNGGAGCVCHLLMDDVVSADNYTLDLWAGQQLLWKGSFKPSEHVKPRAPGNLTVHTNVSDTLLLTWSNPYPPDNYLYNHLTYAVNIWSENDPADFRIYNVTYLEPSLRIAASTLKSGISYRARVRAWAQCYNTTWSEWSPSTKWHNSYREPFEQH Predict reactive species\nFull Name: interleukin 4 receptor\nCalculated Molecular Weight: 90 kDa\nGenBank Accession Number: NM_000418.4\nGene Symbol: IL-4R\nGene ID (NCBI): 3566\nRRID: AB_3672335\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P24394-1\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888699297961,"sku":"98203-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-98203-1-rr","provider":"Iright","version":"1.0","type":"link"}