{"product_id":"proteintech-98233-1-rr","title":"Proteintech, 98233-1-RR, Anti-Mouse CXCR4\/CD184 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CXCR4\/CD184 (98233-1-RR) by Proteintech is a Recombinant antibody targeting CXCR4\/CD184 in FC applications with reactivity to mouse samples\n98233-1-RR targets CXCR4\/CD184 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: mouse thymocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC-X-C chemokine receptor type 4 (CXCR4, also known as CD184) is a widely expressed G protein-coupled seven-transmembrane receptor. CXCL12\/SDF-1 is the biological ligand for CXCR4. The binding of CXCL12 to CXCR4 induces intracellular signaling through several divergent pathways initiating signals related to chemotaxis, cell survival and\/or proliferation, increase in intracellular calcium, and gene transcription (PMID: 20484021). CXCR4 also functions as a coreceptor for HIV-1 entry (PMID: 9427609).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2231 Product name: Recombinant Mouse CXCR4 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 1-40 aa of NM_009911.3 Sequence: MEPISVSIYTSDNYSEEVGSGDYDSNKEPCFRDENVHFNR Predict reactive species\nFull Name: chemokine (C-X-C motif) receptor 4\nCalculated Molecular Weight: 40kDa\nGenBank Accession Number: NM_009911.3\nGene Symbol: Cxcr4\nGene ID (NCBI): 12767\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P70658\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888569995433,"sku":"98233-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-98233-1-rr","provider":"Iright","version":"1.0","type":"link"}