{"product_id":"proteintech-98241-1-rr","title":"Proteintech, 98241-1-RR, Anti-Mouse PD-L2\/CD273 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe PD-L2\/CD273 (98241-1-RR) by Proteintech is a Recombinant antibody targeting PD-L2\/CD273 in FC applications with reactivity to mouse samples\n98241-1-RR targets PD-L2\/CD273 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: GM-CSF treated mouse splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProgrammed cell death ligand 2 (PD-L2, also known as CD273, or B7-DC), is one of the B7 family molecules which are type I transmembrane proteins belonging to the immunoglobulin superfamily. PD-L2 was identified both by its homology to PD-L1 and by analysis of genes differentially expressed in libraries generated from dendritic cells (DC) and activated macrophages (PMID: 14515254). PD-L2 is a second ligand for PD-1, a costimulatory molecule that plays an inhibitory role in regulating T cell activation in the periphery.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1842 Product name: Recombinant Mouse PD-L2\/B7-DC protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 20-219 aa of NM_021396.2 Sequence: LFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPR Predict reactive species\nFull Name: programmed cell death 1 ligand 2\nCalculated Molecular Weight: 28kDa\nGenBank Accession Number: NM_021396.2\nGene Symbol: Pdcd1lg2\nGene ID (NCBI): 58205\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: Q9WUL5\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888580677801,"sku":"98241-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-98241-1-rr","provider":"Iright","version":"1.0","type":"link"}