{"product_id":"proteintech-98270-1-rr","title":"Proteintech, 98270-1-RR, Anti-Mouse CD9 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CD9 (98270-1-RR) by Proteintech is a Recombinant antibody targeting CD9 in FC applications with reactivity to mouse samples\n98270-1-RR targets CD9 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: mouse bone marrow cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1397 Product name: Recombinant Mouse CD9 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 110-193 aa of NM_007657.3 Sequence: THKDEVIKELQEFYKDTYQKLRSKDEPQRETLKAIHMALDCCGIAGPLEQFISDTCPKKQLLESFQVKPCPEAISEVFNNKFHI Predict reactive species\nFull Name: CD9 antigen\nCalculated Molecular Weight: 25 kDa\nGenBank Accession Number: NM_007657.3\nGene Symbol: Cd9\nGene ID (NCBI): 12527\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P40240\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888568783017,"sku":"98270-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-98270-1-rr","provider":"Iright","version":"1.0","type":"link"}