{"product_id":"proteintech-98280-1-rr","title":"Proteintech, 98280-1-RR, Anti-Human CCL22\/MDC Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CCL22\/MDC (98280-1-RR) by Proteintech is a Recombinant antibody targeting CCL22\/MDC in FC (Intra) applications with reactivity to human samples\n98280-1-RR targets CCL22\/MDC in FC (Intra) applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: human monocyte-derived mature dendritic cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe C-C motif chemokine ligand 22 (CCL22), also known as MDC, belongs to the group of chemokines, that are both constitutively expressed under homeostatic conditions and inducible upon inflammation. CCL22 is a secreted protein that exerts chemotactic activity for monocytes, dendritic cells, natural killer cells, and for chronically activated T lymphocytes. CCL22 is induced by LPS, IL-4, and IL-13 and in T cells by TCR stimulation. Accumulating studies indicate that CCL22 recruits regulatory T (T-reg) cells into tumor tissues and is expressed in many human tumors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1974 Product name: Recombinant Human CCL22 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 25-93 aa of BC027952 Sequence: GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ Predict reactive species\nFull Name: chemokine (C-C motif) ligand 22\nCalculated Molecular Weight: 93 aa, 11 kDa\nGenBank Accession Number: BC027952\nGene Symbol: CCL22\/MDC\nGene ID (NCBI): 6367\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: O00626\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888539062441,"sku":"98280-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-98280-1-rr","provider":"Iright","version":"1.0","type":"link"}