{"product_id":"proteintech-98288-1-rr","title":"Proteintech, 98288-1-RR, Anti-Mouse CD25\/IL-2RA Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CD25\/IL-2RA (98288-1-RR) by Proteintech is a Recombinant antibody targeting CD25\/IL-2RA in FC applications with reactivity to mouse samples\n98288-1-RR targets CD25\/IL-2RA in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: Anti-CD3\/CD28 treated mouse splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nProliferation of T lymphocytes is triggered by the interaction of IL-2 with its specific receptor following T lymphocyte activation. The receptor for IL-2 has three forms, generated by different combinations of three different proteins, the alpha chain (IL-2R alpha), the beta chain (IL-2R beta), and the gamma chain (IL-2R gamma) (PMID: 8476561). IL-2R alpha (also known as CD25) is a type I transmembrane protein present on activated T cells, activated B cells, some thymocytes, myeloid precursors, and oligodendrocytes. CD25 is also found on natural CD4+Foxp3+ Treg cells and a subset of human CD4+ memory T cells (PMID: 22585674).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3087 Product name: Recombinant Mouse CD25\/IL2RA protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 22-236 aa of NM_008367.3 Sequence: ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLKELVYMRCLGNSWSSNCQCTSNSHDKSRKQVTAQLEHQKEQQTTTDMQKPTQSMHQENLTGHCREPPPWKHEDSKRIYHFVEGQSVHYECIPGYKALQRGPAISICKMKCGKTGWTQPQLTCVDEREHHRFLASEESQGSRNSSPESETSCPITTTDFPQPTETTAMTETFVLTMEYK Predict reactive species\nFull Name: interleukin 2 receptor, alpha chain\nCalculated Molecular Weight: 31 kDa\nGenBank Accession Number: NM_008367.3\nGene Symbol: CD25\nGene ID (NCBI): 16184\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purfication\nUNIPROT ID: P01590\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888566128809,"sku":"98288-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-98288-1-rr","provider":"Iright","version":"1.0","type":"link"}