{"product_id":"proteintech-98365-2-rr","title":"Proteintech, 98365-2-RR, Anti-Human NCR3\/NKp30 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe NCR3\/NKp30 (98365-2-RR) by Proteintech is a Recombinant antibody targeting NCR3\/NKp30 in FC applications with reactivity to human samples\n98365-2-RR targets NCR3\/NKp30 in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: human peripheral blood leukocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNKp30 (CD337) (NCR3) is a 30-kDa type I transmembrane protein characterized by a single V-type immunoglobulin (Ig) extracellular domain. NKp30 expression is mostly restricted to NK cells although recent studies found this NCR to be present on the surface of additional immune cells, including γδ T cells and Innate Lymphoid Cells (ILCs). NKp30 is involved in NK cell-mediated killing of various tumor cell lines, virus-infected cells and also of autologous dendritic cells (DCs) during the so-called \"editing\" process.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg31663 Product name: Recombinant Human NCR3 protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc \u0026amp; 6*His Domain: 19-135 aa of BC052582 Sequence: LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLG Predict reactive species\nFull Name: natural cytotoxicity triggering receptor 3\nCalculated Molecular Weight: 201 aa, 22 kDa\nGenBank Accession Number: BC052582\nGene Symbol: NCR3\nGene ID (NCBI): 259197\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O14931\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888556822697,"sku":"98365-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-98365-2-rr","provider":"Iright","version":"1.0","type":"link"}