{"product_id":"proteintech-98371-1-rr","title":"Proteintech, 98371-1-RR, Anti-Human CD336 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CD336 (98371-1-RR) by Proteintech is a Recombinant antibody targeting CD336 in FC applications with reactivity to human samples\n98371-1-RR targets CD336 in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: Transfected HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD336, also named as NCR2, LY95 and NKp44, belongs to the natural cytotoxicity receptor (NCR) family. It is cytotoxicity-activating receptor that may contribute to the increased efficiency of activated natural killer (NK) cells to mediate tumor cell lysis. It is expressed on activated human NK cells. CD336  displays a single extracellular Ig-like V domain and a transmembrane portion containing the charged residue (Lysine), likely involved in the association with KARAP\/DAP12 molecules. The antibody is specific to CD336.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1594 Product name: Recombinant Human CD336 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-190 aa of NM_004828 Sequence: QSKAQVLQSVAGQTLTVRCQYPPTGSLYEKKGWCKEASALVCIRLVTSSKPRTMAWTSRFTIWDDPDAGFFTVTMTDLREEDSGHYWCRIYRPSDNSVSKSVRFYLVVSPASASTQTSWTPRDLVSSQTQTQSCVPPTAGARQAPESPSTIPVPSQPQNSTLRPGPAAP Predict reactive species\nFull Name: natural cytotoxicity triggering receptor 2\nCalculated Molecular Weight: 31 kDa\nGenBank Accession Number: NM_004828\nGene Symbol: CD336\nGene ID (NCBI): 9436\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O95944\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888695759017,"sku":"98371-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-98371-1-rr","provider":"Iright","version":"1.0","type":"link"}