{"product_id":"proteintech-98382-2-rr","title":"Proteintech, 98382-2-RR, Anti-Mouse TWEAKR\/CD266 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe TWEAKR\/CD266 (98382-2-RR) by Proteintech is a Recombinant antibody targeting TWEAKR\/CD266 in FC applications with reactivity to mouse samples\n98382-2-RR targets TWEAKR\/CD266 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: Transfected HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTWEAKR (also known as CD266, FN14, TNFRSF12A) is a member of the TNF receptor superfamily which is activated by its ligand, the cytokine TWEAK (TNFSF12). TWEAKR is the smallest member of the TNFR superfamily. TweakR was first described as an FGF-inducible gene that played a role in fibroblast adhesion and migration. Subsequently, the induction of TweakR expression by other growth factors and\/or upon tissue injury was observed in multiple cell types, including hepatocytes, endothelial cells, adipocytes, and cardiomyocytes. (PMID: 23073510, PMID: 24409185)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1838 Product name: Recombinant Mouse TWEAKR\/CD266 protein (rFc Tag) (HPLC-verified) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 28-80 aa of NM_013749.2 Sequence: EQAPGTSPCSSGSSWSADLDKCMDCASCPARPHSDFCLGCAAAPPAHFRLLWP Predict reactive species\nFull Name: tumor necrosis factor receptor superfamily, member 12a\nCalculated Molecular Weight: 14kDa\nGenBank Accession Number: NM_013749.2\nGene Symbol: Tnfrsf12a\nGene ID (NCBI): 27279\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9CR75\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888705261737,"sku":"98382-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-98382-2-rr","provider":"Iright","version":"1.0","type":"link"}