{"product_id":"proteintech-98414-4-rr","title":"Proteintech, 98414-4-RR, Anti-Human Prion protein PrP\/CD230 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe Prion protein PrP\/CD230 (98414-4-RR) by Proteintech is a Recombinant antibody targeting Prion protein PrP\/CD230 in FC applications with reactivity to human samples\n98414-4-RR targets Prion protein PrP\/CD230 in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: human PBMCs\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe major prion protein (PrP), also known as CD230, is encoded by the prion protein-encoding gene (PRNP). PrP is widely expressed in a variety of tissues and is abundant in the nervous system and participates in neuronal growth and survival. PrP expression is strongly associated with immune infiltrating cells, immunosuppressive cell infiltration and immune checkpoint molecules. PrP is an immune-related prognostic marker that holds promise for predicting outcomes related to colorectal cancer immunotherapy.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3359 Product name: Recombinant Human Prion protein PrP protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 23-229 aa of BC012844 Sequence: KKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRG Predict reactive species\nFull Name: prion protein\nGenBank Accession Number: BC012844\nGene Symbol: PrP\nGene ID (NCBI): 5621\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P04156\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888557740201,"sku":"98414-4-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-98414-4-rr","provider":"Iright","version":"1.0","type":"link"}