{"product_id":"proteintech-98424-3-rr","title":"Proteintech, 98424-3-RR, Anti-Mouse uPAR\/CD87 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe uPAR\/CD87 (98424-3-RR) by Proteintech is a Recombinant antibody targeting uPAR\/CD87 in FC applications with reactivity to mouse samples\n98424-3-RR targets uPAR\/CD87 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: Transfected HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nuPAR, also known as CD87, is a highly glycosylated, GPI-anchored membrane protein. In addition to the membrane-anchored form, uPAR is released from the plasma membrane by cleavage of the GPI anchor and can be found as a soluble form (suPAR). uPAR contains three homologous domains (D1-D3) of which the N-terminal one (D1) represents the uPA-binding domain. After binding to uPAR, uPA cleaves plasminogen, generating the active protease plasmin which is involved in a wide variety of physiologic and pathologic processes. In addition to regulating proteolysis, uPAR has important function in cell adhesion, migration and proliferation. Studies reveal that uPAR expression is elevated during inflammation and tissue remodeling and in many human cancers, in which it frequently indicates poor prognosis. (PMID 20027185; 12461559)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3156 Product name: Recombinant Mouse uPAR\/CD87 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 24-297 aa of NM_011113.4 Sequence: LQCMQCESNQSCLVEECALGQDLCRTTVLREWQDDRELEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRPRPGARGRAFPQGRYLECASCTSLDQSCERGREQSLQCRYPTEHCIEVVTLQSTERSLKDEDYTRGCGSLPGCPGTAGFHSNQTFHFLKCCNYTHCNGGPVLDLQSFPPNGFQCYSCEGNNTLGCSSEEASLINCRGPMNQCLVATGLDVLGNRSYTVRGCATASWCQGSHVADSFPTHLNVSVSCCHGSGCNSPT Predict reactive species\nFull Name: plasminogen activator, urokinase receptor\nCalculated Molecular Weight: 35 kDa\nGenBank Accession Number: NM_011113.4\nGene Symbol: Plaur\nGene ID (NCBI): 18793\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P35456\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888582348969,"sku":"98424-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-98424-3-rr","provider":"Iright","version":"1.0","type":"link"}