{"product_id":"proteintech-98425-3-rr","title":"Proteintech, 98425-3-RR, Anti-Mouse CD74 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CD74 (98425-3-RR) by Proteintech is a Recombinant antibody targeting CD74 in FC applications with reactivity to mouse samples\n98425-3-RR targets CD74 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: mouse splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD74, also known as MHC class II invariant chain Ii or HLA-DR-associated invariant chain, is a non-polymorphic type II transmembrane glycoprotein. CD74 is mainly distributed in B cells, monocytes, Langerhans cells, dendritic cells and thymic epithelial cells, and is also expressed in epithelial cells. CD74 plays a key role in MHC class II antigen processing and also serves as a cell surface receptor for the macrophage cytokine MIF. CD74 plays an important role in cardiovascular diseases such as atherosclerosis, ischemic heart disease, and myocardial hypertrophy.(PMID: 15475450; PMID: 27752708; PMID: 38992165; PMID: 36712241).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2716 Product name: Recombinant Mouse Cd74 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 56-279 aa of NM_001042605.1 Sequence: QQQGRLDKLTITSQNLQLESLRMKLPKSAKPVSQMRMATPLLMRPMSMDNMLLGPVKNVTKYGNMTQDHVMHLLTRSGPLEYPQLKGTFPENLKHLKNSMDGVNWKIFESWMKQWLLFEMSKNSLEEKKPTEAPPKVLTKCQEEVSHIPAVYPGAFRPKCDENGNYLPLQCHGSTGYCWCVFPNGTEVPHTKSRGRHNCSEPLDMEDLSSGLGVTRQELGQVTL Predict reactive species\nFull Name: CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated)\nCalculated Molecular Weight: 32 kDa\nGenBank Accession Number: NM_001042605.1\nGene Symbol: Cd74\nGene ID (NCBI): 16149\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P04441-1\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888568225961,"sku":"98425-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-98425-3-rr","provider":"Iright","version":"1.0","type":"link"}