{"product_id":"proteintech-98438-1-rr","title":"Proteintech, 98438-1-RR, Anti-Human TGFBR2 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe TGFBR2 (98438-1-RR) by Proteintech is a Recombinant antibody targeting TGFBR2 in FC applications with reactivity to human samples\n98438-1-RR targets TGFBR2 in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: human PBMCs, human peripheral blood leukocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTGF beta Receptor II (TGFBR2) is a member of the transforming growth factor-β (TGF-β) superfamily, which are critical regulators of cell proliferation and differentiation, developmental patterning and morphogenesis, and disease pathogenesis (PMID: 10974075). TGFBR2 is a serine\/threonine kinase and the primary ligand-binding receptor. After binding of the ligand TGF-β1, TGFBR2 forms a heterodimer complex with TGFBR1, causing conformational changes and signal propagation via canonical (SMAD-dependent) and non-canonical (SMAD-independent) routes. Upon translocation into the nucleus, activated SMAD complexes can interact with various transcription factors to control target gene expression (PMID: 31454892).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2943 Product name: Recombinant Human TGFBR2 protein (rFc Tag)(HPLC verified) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 23-159 aa of NM_003242.5 Sequence: TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPD Predict reactive species\nFull Name: transforming growth factor, beta receptor II (70\/80kDa)\nCalculated Molecular Weight: 65 kDa\nGenBank Accession Number: NM_003242.5\nGene Symbol: TGFBR2\nGene ID (NCBI): 7048\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P37173-1\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888558821545,"sku":"98438-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-98438-1-rr","provider":"Iright","version":"1.0","type":"link"}