{"product_id":"proteintech-98464-1-rr","title":"Proteintech, 98464-1-RR, Anti-Mouse CCL11\/Eotaxin Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CCL11\/Eotaxin (98464-1-RR) by Proteintech is a Recombinant antibody targeting CCL11\/Eotaxin in FC (Intra) applications with reactivity to mouse samples\n98464-1-RR targets CCL11\/Eotaxin in FC (Intra) applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: Transfected HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCL11 also named Eotaxin-1, was initially discovered as an eosinophil-specific chemoattractant. CCL11 plays a central role in both allergic and non-allergic inflammatory reactions by recruiting immune cells such as eosinophils,basophils and Th2 lymphocytes. CCL11 binds to the chemokine receptors CCR2, CCR3 and CCR5, with highest affinity to CCR3. High levels of CCL11 have been described in several chronic inflammatory diseases, such as allergic rhinitis, atopic dermatitis, asthma, gastrointestinal disease and rheumatoid arthritis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2400 Product name: recombinant mouse Ccl11 protein Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 24-97 aa of NM_011330 Sequence: HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP Predict reactive species\nFull Name: chemokine (C-C motif) ligand 11\nCalculated Molecular Weight: 11kd\nGenBank Accession Number: NM_011330\nGene Symbol: Ccl11\nGene ID (NCBI): 20292\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P48298\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888560492713,"sku":"98464-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-98464-1-rr","provider":"Iright","version":"1.0","type":"link"}