{"product_id":"proteintech-98466-3-rr","title":"Proteintech, 98466-3-RR, Anti-Mouse GITR\/TNFRSF18 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe GITR\/TNFRSF18 (98466-3-RR) by Proteintech is a Recombinant antibody targeting GITR\/TNFRSF18 in FC applications with reactivity to mouse samples\n98466-3-RR targets GITR\/TNFRSF18 in IF, FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: mouse splenocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlucocorticoid-induced TNFR-related protein (GITR), also known as CD357 or TNFRSF18, is a member of the tumor necrosis factor receptor (TNF-R) superfamily. GITR is expressed constitutively at high levels in T regulatory cells (Treg cells) and plays a key role in dominant immunological self-tolerance maintained by CD25+CD4+ regulatory T cells (PMID: 11812990). It is expressed at low levels on resting responder T cells. The expression of GITR on T cells can be upregulated upon activation (PMID: 15770698). GITR is activated by GITR ligand (GITRL) which is mainly expressed on APC. GITR-GITRL interactions could co-stimulate both responder T-cell functions and the suppressive functions of Treg cells (PMID: 16868552).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3695 Product name: Recombinant Mouse GITR\/TNFRSF18 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 20-153 aa of NM_009400.2 Sequence: QPSVVEEPGCGPGKVQNGSGNNTRCCSLYAPGKEDCPKERCICVTPEYHCGDPQCKICKHYPCQPGQRVESQGDIVFGFRCVACAMGTFSAGRDGHCRLWTNCSQFGFLTMFPGNKTHNAVCIPEPLPTEQYGH Predict reactive species\nFull Name: tumor necrosis factor receptor superfamily, member 18\nCalculated Molecular Weight: 25kDa\nGenBank Accession Number: NM_009400.2\nGene Symbol: CD357\nGene ID (NCBI): 21936\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O35714-1\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888532050089,"sku":"98466-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-98466-3-rr","provider":"Iright","version":"1.0","type":"link"}