{"product_id":"proteintech-98504-1-rr","title":"Proteintech, 98504-1-RR, Anti-Human IL-29 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe IL-29 (98504-1-RR) by Proteintech is a Recombinant antibody targeting IL-29 in FC (Intra) applications with reactivity to human samples\n98504-1-RR targets IL-29 in FC (Intra) applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: Transfected CHO cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin-29 (IL-29) is a cytokine belonging to the Type III interferon family, which has another two subfamilies IL-28A and IL-28B. They are also known as IFN-λ1, IFN-λ2 and IFN-λ3, respectively. IL-29 is produced predominantly by maturing dendritic cells and macrophages. IL-29 plays an important role in the immune response against pathogenes and especially against viruses by mechanisms similar to type I interferons. IL-29 receptor signals through JAK-STAT pathways leading to activated expression of interferon-stimulated genes and production of antiviral proteins.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2843 Product name: Recombinant Human IL29 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 20-200 aa of NM_172140.1 Sequence: GPVPTSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST Predict reactive species\nFull Name: interleukin 29 (interferon, lambda 1)\nCalculated Molecular Weight: 22 kDa\nGenBank Accession Number: NM_172140.1\nGene Symbol: IL-29\nGene ID (NCBI): 282618\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8IU54\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888553611433,"sku":"98504-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-98504-1-rr","provider":"Iright","version":"1.0","type":"link"}