{"product_id":"proteintech-98524-3-rr","title":"Proteintech, 98524-3-RR, Anti-Human OLR1\/LOX1 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe OLR1\/LOX1 (98524-3-RR) by Proteintech is a Recombinant antibody targeting OLR1\/LOX1 in FC applications with reactivity to human samples\n98524-3-RR targets OLR1\/LOX1 in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: GM-CSF treated human PBMCs\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOLR1\/LOX-1 acts as a receptor, in the form of homodimer, that mediates the recognition, internalization, and degradation of oxidatively modified low density lipoprotein (oxLDL) (PMID: 9052782, 15695803). ORL1 is predominantly expressed in endothelial cells and vascular-rich organs such as the placenta, lung, liver, and brain (PMID: 9828121). OLR1 is a protein containing 273 amino acids with a calculated molecular mass of 31 kDa but an apparent molecular mass of 50 kDa, which may result from the glycosylation of four potential N-linked glycosylation sites located at the C-terminal domain (PMID: 9052782).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2911 Product name: Recombinant Human OLR1\/LOX1 protein (rFc Tag) Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 61-273 aa of NM_002543.3 Sequence: SQVSDLLTQEQANLTHQKKKLEGQISARQQAEEASQESENELKEMIETLARKLNEKSKEQMELHHQNLNLQETLKRVANCSAPCPQDWIWHGENCYLFSSGSFNWEKSQEKCLSLDAKLLKINSTADLDFIQQAISYSSFPFWMGLSRRNPSYPWLWEDGSPLMPHLFRVRGAVSQTYPSGTCAYIQRGAVYAENCILAAFSICQKKANLRAQ Predict reactive species\nFull Name: oxidized low density lipoprotein (lectin-like) receptor 1\nCalculated Molecular Weight: 31 kDa\nGenBank Accession Number: NM_002543.3\nGene Symbol: OLR1\nGene ID (NCBI): 4973\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P78380-1\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888557117609,"sku":"98524-3-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-98524-3-rr","provider":"Iright","version":"1.0","type":"link"}