{"product_id":"proteintech-98562-1-rr","title":"Proteintech, 98562-1-RR, Anti-Mouse CXCL13\/BCA1 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CXCL13\/BCA1 (98562-1-RR) by Proteintech is a Recombinant antibody targeting CXCL13\/BCA1 in IHC, FC (Intra) applications with reactivity to mouse samples\n98562-1-RR targets CXCL13\/BCA1 in IHC, FC (Intra) applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: mouse peritoneal macrophages\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCXCL13 (C-X-C motif chemokine 13), originally named B-lymphocyte chemoattractant (BLC) or B cell-attracting chemokine 1 (BCA-1), is a homeostatic chemokine that is constitutively secreted by stromal cells in the B-cell follicles of secondary lymphoid tissues (e.g., spleen, lymph nodes, tonsils, and Peyer's patches). It plays a crucial role in orchestrating cell migration within distinct regions of secondary lymphoid organs, strongly attracting B lymphocytes (and, to a lesser extent, T cells and macrophages) via its receptor CXCR5 (originally named Burkitt's lymphoma receptor 1, BLR1). In addition to maintaining immune cell trafficking and lymphoid follicle development, CXCL13 is implicated in inflammatory and autoimmune diseases (e.g., systemic lupus erythematosus, rheumatoid arthritis) and tumor progression (e.g., multiple myeloma).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3331 Product name: Recombinant Mouse Cxcl13 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 22-109 aa of NM_018866 Sequence: ILEAHYTNLKCRCSGVISTVVGLNIIDRIQVTPPGNGCPKTEVVIWTKMKKVICVNPRAKWLQRLLRHVQSKSLSSTPQAPVSKRRAA Predict reactive species\nFull Name: chemokine (C-X-C motif) ligand 13\nCalculated Molecular Weight: 12 kDa\nGenBank Accession Number: NM_018866\nGene Symbol: Cxcl13\nGene ID (NCBI): 55985\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O55038\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888569536681,"sku":"98562-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-98562-1-rr","provider":"Iright","version":"1.0","type":"link"}