{"product_id":"proteintech-98589-1-rr","title":"Proteintech, 98589-1-RR, Anti-Human ATP1B3 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe ATP1B3 (98589-1-RR) by Proteintech is a Recombinant antibody targeting ATP1B3 in FC applications with reactivity to human samples\n98589-1-RR targets ATP1B3 in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: FC receptor blocked human peripheral blood leukocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nATP1B3 (also known as CD298) is the β3 subunit of Na+\/K+-ATPase which functions to maintain sodium and potassium gradients across membranes involved in cellular activities. ATP1B3 is a glycosylated protein and there are fully and intermediately glycosylated forms of ATP1B3 in mammalian cells. The predicted MW of ATP1B3 is around 32 kDa, while various forms (38-43 kDa) can be observed due to the different level of glycosylation (PMID: 30792309, 16339171, 17176442).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg4947 Product name: Recombinant Human ATP1B3 protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 57-279 aa of BC011835 Sequence: TMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPVTALEYTFSRSDPTSYAGYIEDLKKFLKPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGVPRIDCVSKNEDIPNVAVYPHNGMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKFLGRVMFKITARA Predict reactive species\nFull Name: ATPase, Na+\/K+ transporting, beta 3 polypeptide\nCalculated Molecular Weight: 32 kDa\nGenBank Accession Number: BC011835\nGene Symbol: ATP1B3\nGene ID (NCBI): 483\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P54709\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888694251689,"sku":"98589-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-98589-1-rr","provider":"Iright","version":"1.0","type":"link"}