{"product_id":"proteintech-98663-1-rr","title":"Proteintech, 98663-1-RR, Anti-Human Glycophorin B\/CD235b Rabbit Recombinant Antibody","description":"Size: 100ug\nThe Glycophorin B\/CD235b (98663-1-RR) by Proteintech is a Recombinant antibody targeting Glycophorin B\/CD235b in FC applications with reactivity to human samples\n98663-1-RR targets Glycophorin B\/CD235b in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: Human peripheral blood erythrocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGlycophorin B\/CD235b (GYPB) is a single-pass transmembrane sialoglycoprotein expressed on the surface of human red blood cells (RBCs). Glycophorin B\/CD235b is primarily known for determining the Ss blood group and playing a role in malaria susceptibility.It is encoded by the GYPB gene and is structurally similar to glycophorin A (GPA), though present at lower abundance.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg3516 Product name: recombinant human GYPB protein Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 20-59 aa of BC121077 Sequence: LSTTEVAMHTSTSSSVTKSYISSQTNGETGQLVHRFTVPA Predict reactive species\nFull Name: glycophorin B (MNS blood group)\nGenBank Accession Number: BC121077\nGene Symbol: GYPB\nGene ID (NCBI): 2994\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P06028\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888698020009,"sku":"98663-1-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-98663-1-rr","provider":"Iright","version":"1.0","type":"link"}