{"product_id":"proteintech-98688-2-rr","title":"Proteintech, 98688-2-RR, Anti-Mouse CD367\/CLEC4A Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CD367\/CLEC4A (98688-2-RR) by Proteintech is a Recombinant antibody targeting CD367\/CLEC4A in FC applications with reactivity to mouse samples\n98688-2-RR targets CD367\/CLEC4A in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: mouse bone marrow cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCLEC4A (also commonly referred to as DCIR) belongs to the C-type lectin receptor (CLR) family and functions primarily as an inhibitory receptor in the immune system. It is a type II transmembrane protein containing a C-type lectin-like domain (CTLD). Uniquely among most CLRs, it possesses an immunoreceptor tyrosine-based inhibitory motif (ITIM) in its cytoplasmic tail (PMID: 35017526). Mice lacking Clec4a2 or Clec4a4 are highly susceptible to autoimmune conditions such as experimental arthritis and experimental autoimmune encephalomyelitis (EAE) due to excessive DC activation (PMID: 27068492).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg5258 Product name: recombinant mouse CD367\/Clec4a protein Source: mammalian cells -derived, V37 Tag: C-rFc Domain: 70-238 aa of NM_001170332.1 Sequence: QKYSQLLEEKKAAKNIMHNELNCTKSVSPMEDKVWSCCPKDWRLFGSHCYLVPTVSSSASWNKSEENCSRMGAHLVVIQSQEEQDFITGILDTHAAYFIGLWDTGHRQWQWVDQTPYEESITFWHNGEPSSGNEKCATIIYRWKTGWGWNDISCSLKQKSVCQMKKINL Predict reactive species\nFull Name: C-type lectin domain family 4, member a2\nCalculated Molecular Weight: 27 kDa\nGenBank Accession Number: NM_001170332.1\nGene Symbol: Clec4a2\nGene ID (NCBI): 26888\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9QZ15\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888702541993,"sku":"98688-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-98688-2-rr","provider":"Iright","version":"1.0","type":"link"}