{"product_id":"proteintech-98702-2-rr","title":"Proteintech, 98702-2-RR, Anti-Pig IFN-gamma Rabbit Recombinant Antibody","description":"Size: 100ug\nThe IFN-gamma (98702-2-RR) by Proteintech is a Recombinant antibody targeting IFN-gamma in FC (Intra) applications with reactivity to pig samples\n98702-2-RR targets IFN-gamma in FC (Intra) applications and shows reactivity with pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: Transfected CHO cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterferon-gamma (IFN γ), is a type II interferon that provides immunity against bacterial, viral and protozoan infections. It is produced by a number of immune cell types including natural killer cells, natural killer T cells, and effector lymphocyte T cells following antigenic and inflammatory triggers. The IFN γ dimer binds to its cognate receptor which has two subunits: IFN-γR1 which is the ligand-binding chain (α chain) and IFN-γR2, the signal-transducing chain (β chain). Binding to the receptor activates the JAK\/STAT pathway which in turn activates IFN γ responsive genes. While IFN γ can inhibit viral replication, it also works as an immune-modulator and immune-stimulator by increasing surface expression of class I MHC proteins (PMID: 19268625; 10688427)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg4538 Product name: Recombinant Pig IFN-gamma protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 24-166 aa of NM_213948.1 Sequence: QAPFFKEITILKDYFNASTSDVPNGGPLFLEILKNWKEESDKKIIQSQIVSFYFKFFEIFKDNQAIQRSMDVIKQDMFQRFLNGSSGKLNDFEKLIKIPVDNLQIQRKAISELIKVMNDLSPRSNLRKRKRSQTMFQGQRASK Predict reactive species\nFull Name: Interferon gamma\nCalculated Molecular Weight: 19 kDa\nGenBank Accession Number: NM_213948.1\nGene Symbol: IFNG\nGene ID (NCBI): 396991\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P17803\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2 - 8°C. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888582643881,"sku":"98702-2-RR","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-98702-2-rr","provider":"Iright","version":"1.0","type":"link"}