{"product_id":"proteintech-apc-fca98016","title":"Proteintech, APC-FcA98016, FcZero-rAb™ APC Anti-Human TLR3\/CD283 Rabbit Recombinant Antibody","description":"Size: 100tests\nThe TLR3\/CD283 (APC-FcA98016) by Proteintech is a Recombinant antibody targeting TLR3\/CD283 in FC (Intra) applications with reactivity to human samples\nAPC-FcA98016 targets TLR3\/CD283 in FC (Intra) applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: human immature monocyte-derived dendritic cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 5 ul per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTLR3 belongs to the Toll-like receptor family which is important in the innate immune response to pathogens. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. TLR3 is a nucleotide-sensing TLR that is activated by double-stranded RNA. Upon recognition of dsRNA, TLR3 transmits signals via the adaptor protein TICAM-1\/TRIF, leading to the induction of type I IFN, cytokine\/chemokine production, and dendritic cell (DC) maturation (PMID: 18262679).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag34044 Product name: Recombinant human TLR3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 725-904 aa of BC094737 Sequence: FEGWRISFYWNVSVHRVLGFKEIDRQTEQFEYAAYIIHAYKDKDWVWEHFSSMEKEDQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQAIEQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSKNSVH Predict reactive species\nFull Name: toll-like receptor 3\nCalculated Molecular Weight: 904 aa, 104 kDa\nGenBank Accession Number: BC094737\nGene Symbol: TLR3\nGene ID (NCBI): 7098\nConjugate: APC Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 650 nm \/ 660 nm\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O15455\nStorage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888626946217,"sku":"APC-FcA98016","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-apc-fca98016","provider":"Iright","version":"1.0","type":"link"}