{"product_id":"proteintech-apc-fca98056","title":"Proteintech, APC-FcA98056, FcZero-rAb™ APC Anti-Human TNF beta Rabbit Recombinant Antibody","description":"Size: 100tests\nThe TNF beta (APC-FcA98056) by Proteintech is a Recombinant antibody targeting TNF beta in FC (Intra) applications with reactivity to human samples\nAPC-FcA98056 targets TNF beta in FC (Intra) applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: Anti-CD3\/CD28 treated human PBMCs\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 5 ul per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTNF beta also known as lymphotoxin alpha (LTA), is a member of the tumor necrosis factor family, and is a cytokine produced by lymphocytes. TNF Beta is highly inducible, secreted, and forms heterotrimers with lymphotoxin-beta which anchor lymphotoxin-alpha to the cell surface. TNF Beta also mediates a large variety of inflammatory, immunostimulatory, and antiviral responses, is involved in the formation of secondary lymphoid organs during development and plays a role in apoptosis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0836 Product name: Recombinant Human TNF-beta protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 35-205 aa of BC034729 Sequence: LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL Predict reactive species\nFull Name: lymphotoxin alpha (TNF superfamily, member 1)\nCalculated Molecular Weight: 205 aa, 22 kDa\nGenBank Accession Number: BC034729\nGene Symbol: TNF beta\nGene ID (NCBI): 4049\nConjugate: APC Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 650 nm \/ 660 nm\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P01374\nStorage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888627011753,"sku":"APC-FcA98056","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-apc-fca98056","provider":"Iright","version":"1.0","type":"link"}