{"product_id":"proteintech-apc-fca98063","title":"Proteintech, APC-FcA98063, FcZero-rAb™ APC Anti-Human LIGHT\/CD258 Rabbit Recombinant Antibody","description":"Size: 100tests\nThe LIGHT\/CD258 (APC-FcA98063) by Proteintech is a Recombinant antibody targeting LIGHT\/CD258 in FC applications with reactivity to human samples\nAPC-FcA98063 targets LIGHT\/CD258 in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: PMA, Ionomycin treated human PBMCs\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLIGHT, also known as TNFSF14, HVEML, or CD258, is a type II transmembrane protein that belongs to the TNF superfamily (PMID: 9462508). It is predominantly expressed in lymphoid tissues and produced by activated T cells and immature dendritic cells (DCs) (PMID: 9462508; 10754304). Through its two primary functional receptors HVEM (TNFRSF14) and lymphotoxin β receptor (LTβR), LIGHT signaling is involved in development and maintenance of lymphoid tissues, as well as innate and adaptive immune responses (PMID: 24575096; 26720335). In addition to the membrane form, LIGHT can also exist as a soluble form generated by cleavage of the extracellular portion of the membrane form.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg32095 Product name: Recombinant Human LIGHT\/CD258 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: N-6*his Domain: 74-240 aa of NM_003807 Sequence: DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV Predict reactive species\nFull Name: tumor necrosis factor (ligand) superfamily, member 14\nCalculated Molecular Weight: 26KD\nGenBank Accession Number: NM_003807\nGene Symbol: LIGHT\nGene ID (NCBI): 8740\nConjugate: APC Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 650 nm \/ 660 nm\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O43557\nStorage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888625275049,"sku":"APC-FcA98063","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-apc-fca98063","provider":"Iright","version":"1.0","type":"link"}