{"product_id":"proteintech-apc-fca98125","title":"Proteintech, APC-FcA98125, FcZero-rAb™ APC Anti-Human TWEAKR\/CD266 Rabbit Recombinant Antibody","description":"Size: 100tests\nThe TWEAKR\/CD266 (APC-FcA98125) by Proteintech is a Recombinant antibody targeting TWEAKR\/CD266 in FC applications with reactivity to human samples\nAPC-FcA98125 targets TWEAKR\/CD266 in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: HT-1080 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTWEAKR (also known as CD266, FN14, TNFRSF12A) is a member of the TNF receptor superfamily which is activated by its ligand, the cytokine TWEAK (TNFSF12). TWEAKR is the smallest member of the TNFR superfamily. TWEAKR was first described as an FGF-inducible gene that played a role in fibroblast adhesion and migration. Subsequently, the induction of TWEAKR expression by other growth factors and\/or upon tissue injury was observed in multiple cell types, including hepatocytes, endothelial cells, adipocytes, and cardiomyocytes. (PMID: 23073510, PMID: 24409185)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Ag13823 Product name: Recombinant human TWEAKR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 19-91 aa of BC002718 Sequence: LALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFV Predict reactive species\nFull Name: tumor necrosis factor receptor superfamily, member 12A\nCalculated Molecular Weight: 129 aa, 14 kDa\nGenBank Accession Number: BC002718\nGene Symbol: TWEAKR\nGene ID (NCBI): 51330\nConjugate: APC Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 650 nm \/ 660 nm\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9NP84\nStorage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888627306665,"sku":"APC-FcA98125","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-apc-fca98125","provider":"Iright","version":"1.0","type":"link"}