{"product_id":"proteintech-apc-fca98133","title":"Proteintech, APC-FcA98133, FcZero-rAb™ APC Anti-Human CD244 Rabbit Recombinant Antibody","description":"Size: 100tests\nThe CD244 (APC-FcA98133) by Proteintech is a Recombinant antibody targeting CD244 in FC applications with reactivity to human samples\nAPC-FcA98133 targets CD244 in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: human PBMCs\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD244, also known as SLAMF4 or 2B4, is a type I transmembrane glycoprotein belonging to the signaling lymphocyte activation molecule (SLAM) family. It consists of an extracellular segment with two immunoglobulin (Ig)-like domains, a transmembrane region, and a cytoplasmic domain containing tyrosine-based motifs (PMID: 9841922; 30546369). CD244 is present on natural killer (NK) cells, γδ T cells, a subset of CD8+ T cells, monocytes, basophils, dendritic cells, and myeloid-derived suppressor cells (MDSCs) (PMID: 30546369). It binds to CD48 with high affinity and transmits stimulatory or inhibitory signals that regulate immune function (PMID: 9841922; 18523281).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg32087 Product name: Recombinant Human CD244 protein (Myc Tag, His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: Myc \u0026amp; 6*His Domain: 22-221 aa of BC053985 Sequence: CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFR Predict reactive species\nFull Name: CD244 molecule, natural killer cell receptor 2B4\nCalculated Molecular Weight: 365 aa, 41 kDa\nGenBank Accession Number: BC053985\nGene Symbol: CD244\nGene ID (NCBI): 51744\nConjugate: APC Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 650 nm \/ 660 nm\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9BZW8\nStorage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888616755369,"sku":"APC-FcA98133","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-apc-fca98133","provider":"Iright","version":"1.0","type":"link"}