{"product_id":"proteintech-apc-fca98181","title":"Proteintech, APC-FcA98181, FcZero-rAb™ APC Anti-Human CD134\/OX40 Rabbit Recombinant Antibody","description":"Size: 100tests\nThe CD134\/OX40 (APC-FcA98181) by Proteintech is a Recombinant antibody targeting CD134\/OX40 in FC applications with reactivity to human samples\nAPC-FcA98181 targets CD134\/OX40 in FC applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: PHA treated human PBMCs\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 5 ul per 10^6 cells in 100 μl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD134, also known as OX40 and TNFRSF4, is a member of the TNFR-superfamily of receptors (PMID: 2828930; 9766631). It is a type I transmembrane protein predominantly expressed on activated T cells which include CD4 and CD8 T cells, Th2, Th1, and Th17 cells, as well as regulatory T cells (Tregs) (PMID: 20307208). CD134 is activated by its cognate ligand CD134L (OX40L) and functions as a T cell co-stimulatory molecule (PMID: 26215166). CD134-CD134L interactions have been proposed as a potential therapeutic target for treating autoimmune diseases, cancer and infectious disease (PMID: 26215166; 19426222).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1261 Product name: Recombinant Human OX40\/TNFRSF4 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 29-214 aa of NM_003327 Sequence: LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRA Predict reactive species\nFull Name: tumor necrosis factor receptor superfamily, member 4\nCalculated Molecular Weight: 29 kDa\nGenBank Accession Number: NM_003327\nGene Symbol: CD134\nGene ID (NCBI): 7293\nConjugate: APC Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 650 nm \/ 660 nm\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P43489\nStorage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888615248041,"sku":"APC-FcA98181","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-apc-fca98181","provider":"Iright","version":"1.0","type":"link"}