{"product_id":"proteintech-apc-fca98217","title":"Proteintech, APC-FcA98217, FcZero-rAb™ APC Anti-Mouse CD79b Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CD79b (APC-FcA98217) by Proteintech is a Recombinant antibody targeting CD79b in FC applications with reactivity to mouse samples\nAPC-FcA98217 targets CD79b in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: mouse bone marrow cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.1 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD79 molecule encompasses two transmembrane proteins, CD79a and CD79b, which form a disulfide-linked heterodimer and are members of the immunoglobulin (Ig) gene superfamily (PMID: 2033258; 1375264; 2304550). CD79b molecule (also known as B29, IGB, AGM6, and Igbeta) is expressed almost exclusively on B cells and B-cell neoplasms, influencing antigen internalization and increasing antigen presentation efficiency (PMID: 7552998). CD79b mutation could be a key biomarker for DLBCL disease progression (PMID: 36182550).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2113 Product name: Recombinant Mouse CD79B protein (rFc Tag) Source: mammalian cells -derived, pHZ-KIsec-C-rFc Tag: C-rFc Domain: 26-158 aa of NM_008339.3 Sequence: VPAMTSSDLPLNFQGSPCSQIWQHPRFAAKKRSSMVKFHCYTNHSGALTWFRKRGSQQPQELVSEEGRIVQTQNGSVYTLTIQNIQYEDNGIYFCKQKCDSANHNVTDSCGTELLVLGFSTLDQLKRRNTLKD Predict reactive species\nFull Name: CD79B antigen\nCalculated Molecular Weight: 26 kDa\nGenBank Accession Number: NM_008339.3\nGene Symbol: Cd79b\nGene ID (NCBI): 15985\nConjugate: APC Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 650 nm \/ 660 nm\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P15530\nStorage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888629993641,"sku":"APC-FcA98217","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-apc-fca98217","provider":"Iright","version":"1.0","type":"link"}