{"product_id":"proteintech-apc-fca98259","title":"Proteintech, APC-FcA98259, FcZero-rAb™ APC Anti-Mouse CXCL2 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CXCL2 (APC-FcA98259) by Proteintech is a Recombinant antibody targeting CXCL2 in FC (Intra) applications with reactivity to mouse samples\nAPC-FcA98259 targets CXCL2 in FC (Intra) applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC (Intra) detected in: LPS and Brefeldin A treated RAW 264.7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.1 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCXCL2 is a member of the CXC subfamily, which encodes secreted proteins involved in immunoregulatory and inflammatory processes. CXCL2 is expressed at sites of inflammation and may suppress hematopoietic progenitor cell proliferation. CXCL2 plays a critical role in maintaining cancer-induced macrophage infiltration and the resulting mechanical hypersensitivity and persistent spontaneous nociception (PMID: 36754246).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg2239 Product name: Recombinant Mouse CXCL2 protein (rFc Tag) (HPLC verified) Source: mammalian cells -derived, pHZ-KIsec-N-rFc Tag: N-rFc Domain: 28-100 aa of NM_009140 Sequence: AVVASELRCQCLKTLPRVDFKNIQSLSVTPPGPHCAQTEVIATLKGGQKVCLDPEAPLVQKIIQKILNKGKAN Predict reactive species\nFull Name: chemokine (C-X-C motif) ligand 2\nCalculated Molecular Weight: 11 kDa\nGenBank Accession Number: NM_009140\nGene Symbol: Cxcl2\nGene ID (NCBI): 20310\nConjugate: APC Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 650 nm \/ 660 nm\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P10889\nStorage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888630649001,"sku":"APC-FcA98259","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-apc-fca98259","provider":"Iright","version":"1.0","type":"link"}