{"product_id":"proteintech-biotin-fca98202","title":"Proteintech, Biotin-FcA98202, FcZero-rAb™ Biotin Anti-Human CD81 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CD81 (Biotin-FcA98202) by Proteintech is a Recombinant antibody targeting CD81 in FC, ELISA applications with reactivity to human samples\nBiotin-FcA98202 targets CD81 in FC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: human peripheral blood leukocytes\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD81 (also known as TAPA1 or TSPAN28) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are expressed on leukocytes and have been implicated in signal transduction, cell-cell interactions, and cellular activation and development. CD81 is involved in signal transduction and cell adhesion in the immune system (PMID: 9597125). CD81 has also been identified as an essential receptor for HCV (hepatitis C virus) (PMID: 21428934).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg1036 Product name: recombinant human CD81 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: N-6*His Domain: 113-201 aa of NM_004356.4 Sequence: FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK Predict reactive species\nFull Name: CD81 molecule\nCalculated Molecular Weight: 26 kDa\nGenBank Accession Number: NM_004356.4\nGene Symbol: CD81\nGene ID (NCBI): 975\nENSEMBL Gene ID: ENSG00000110651\nConjugate: Biotin\nExcitation\/Emission Maxima Wavelengths: -\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P60033\nStorage Buffer: PBS with 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888622522537,"sku":"Biotin-FcA98202","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-biotin-fca98202","provider":"Iright","version":"1.0","type":"link"}