{"product_id":"proteintech-biotin-sf98095","title":"Proteintech, Biotin-SF98095, Biotin Anti-Human CD9 Rabbit scFv Antibody","description":"Size: 100ug\nThe CD9 (Biotin-SF98095) by Proteintech is a Recombinant antibody targeting CD9 in FC, ELISA applications with reactivity to human samples\nBiotin-SF98095 targets CD9 in FC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: human PBMCs\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Type: Rabbit \/ scFv\nClass: Recombinant\nType: Single-chain variable fragment antibody (scFv)\nImmunogen: CatNo: Eg1037 Product name: recombinant human CD9 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 112-195 aa of NM_001769.4 Sequence: SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI Predict reactive species\nFull Name: CD9 molecule\nCalculated Molecular Weight: 25 kDa\nGenBank Accession Number: NM_001769.4\nGene Symbol: CD9\nGene ID (NCBI): 928\nConjugate: Biotin\nExcitation\/Emission Maxima Wavelengths: -\nSource: Anti-Human CD9 scFv from clone 240830E6, consisting of VL-GGGGS linker-VH (N- to C-terminus), with His tag at the C-terminus.\nForm: Liquid\nPurification Method: Affinity purification\nStorage Buffer: PBS with 4% sucrose and 0.09% sodium azide, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888547188905,"sku":"Biotin-SF98095","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-biotin-sf98095","provider":"Iright","version":"1.0","type":"link"}