{"product_id":"proteintech-cl488-60135","title":"Proteintech, CL488-60135, CoraLite® Plus 488-conjugated Chromogranin A Monoclonal antibody","description":"Size: 100ul\nThe Chromogranin A (CL488-60135) by Proteintech is a Monoclonal antibody targeting Chromogranin A in IF\/ICC, FC (Intra) applications with reactivity to human, mouse, rat, pig samples\nCL488-60135 targets Chromogranin A in IF\/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IF\/ICC detected in: PC-12 cells, SH-SY5Y cells,  Neuro-2a cells\nPositive FC (Intra) detected in: SH-SY5Y cells, Neuro-2a cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nChromogranin A is a member of the granin family of neuroendocrine secretory proteins. It is located in secretory vesicles of neurons and endocrine cells. Chromogranin A is the precursor to several functional peptides including vasostatin, pancreastatin, catestatin and parastatin. These peptides negatively modulate the neuroendocrine function of the releasing cell (autocrine) or nearby cells (paracrine). CgA is one of the most used tumor markers in NET's (neuroendocrine tumors) , and elevated CgA concentrations have been demonstrated in serum or plasma of patients with different types of these tumors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag0807 Product name: Recombinant human CHGA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 158-457 aa of BC006459 Sequence: MQESKAEGNNQAPGEEEEEEEEATNTHPPASLPSQKYPGPQAEGDSEGLSQGLVDREKGLSAEPGWQAKREEEEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARAYGFRGPGPQLRRGWRPSSREDSLEAGLPLQVRGYPEEKKEEEGSANRRPEDQELESLSAIEAELEKVAHQLQALRRG Predict reactive species\nFull Name: chromogranin A (parathyroid secretory protein 1)\nCalculated Molecular Weight: 51 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC006459\nGene Symbol: Chromogranin A\nGene ID (NCBI): 1113\nRRID: AB_2934426\nConjugate: CoraLite® Plus 488 Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 493 nm \/ 522 nm\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P10645\nStorage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.\nStorage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888109342889,"sku":"CL488-60135","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-cl488-60135","provider":"Iright","version":"1.0","type":"link"}