{"product_id":"proteintech-g66427-1-5c","title":"Proteintech, G66427-1-5C, MultiPro® 5CFLX Anti-Human STAT5B (1D9B11)","description":"Size: 10ug\nThe STAT5B (G66427-1-5C) by Proteintech is a Monoclonal antibody targeting STAT5B in Single Cell (Intra) applications with reactivity to Human samples\nG66427-1-5C targets STAT5B in Single Cell (Intra) applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product.\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nSINGLE CELL (INTRA): \u0026lt;0.5ug\/test\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSTAT5B belongs to the transcription factor STAT family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT5B carries out a dual function: signal transduction and activation of transcription. STAT5B mediates the signal transduction triggered by various cell ligands, such as IL2, IL4, CSF1, and different GH. It has been shown to be involved in diverse biological processes, such as TCR signaling, apoptosis, adult mammary gland development, and sexual dimorphism of liver gene expression. Despite the 95% homology between the immunogen (Ag2709) and the STAT5A protein, our WB detection showed that this antibody does not recognize the STAT5A fusion protein (Ag19546).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Oligo Conjugate\nType: Monoclonal\nImmunogen: CatNo: Ag2709 Product name: Recombinant human STAT5B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-351 aa of BC020868 Sequence: MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDNPQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDRCPMELVRCIRHILYNEQRLVREANNGSSPAGSLADAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFGPLAQLSPQERLSRETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAAT Predict reactive species\nFull Name: MultiPro® 5CFLX Anti-Human STAT5B (1D9B11)\nCalculated Molecular Weight: 787 aa, 90 kDa\nGenBank Accession Number: BC020868\nGene Symbol: STAT5B\nGene ID (NCBI): 6777\nENSEMBL Gene ID: ENSG00000173757\nRRID: AB_3673954\nConjugate: 5CFLX\nFull Oligo Sequence: CGGAGATGTGTATAAGAGACAGCTCCTATTGGAGTGGCCCATATAAGAAA\nBarcode Sequence: CTCCTATTGGAGTGG\nForm: Liquid\nUNIPROT ID: P51692\nStorage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3.\nStorage Conditions: 2-8°C Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888299856041,"sku":"G66427-1-5C","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-g66427-1-5c","provider":"Iright","version":"1.0","type":"link"}