{"product_id":"proteintech-g66659-1-5c","title":"Proteintech, G66659-1-5C, MultiPro® 5CFLX Anti-Human POU2AF1 (3C5A7)","description":"Size: 10ug\nThe POU2AF1 (G66659-1-5C) by Proteintech is a Monoclonal antibody targeting POU2AF1 in Single Cell (Intra) applications with reactivity to Human samples\nG66659-1-5C targets POU2AF1 in Single Cell (Intra) applications and shows reactivity with Human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive Single Cell (Intra) detected in: 10x Genomics Gene Expression Flex with Feature Barcodes and Multiplexing product.\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nSINGLE CELL (INTRA): \u0026lt;0.5ug\/test\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPOU2AF1, also named as BOB-1 or OCA-B, is a 256 amino acid protein, which belongs to the POU2AF1 family. POU2AF1 is expressed in B-cell specific. POU2AF1 as a transcriptional coactivator that specifically associates with either OCT1 or OCT2. It boosts the OCT1 mediated promoter activity and to a lesser extent, that of OCT2. It has no intrinsic DNA-binding activity. It recognizes the POU domains of OCT1 and OCT2. It is essential for the response of B-cells to antigens and required for the formation of germinal centers.The predicted size of this protein is 27 kDa. Studies have reported that the protein has a multi-band size of 34-35 kDa through siRNA interference experiments (PMID: 17621271). This result is the same as our experiments.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Oligo Conjugate\nType: Monoclonal\nImmunogen: CatNo: Ag23613 Product name: Recombinant human POU2AF1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-256 aa of BC032549 Sequence: MLWQKPTAPEQAPAPARPYQGVRVKEPVKELLRRKRGHASSGAAPAPTAVVLPHQPLATYTTVGPSCLDMEGSVSAVTEEAALCAGWLSQPTPATLQPLAPWTPYTEYVPHEAVSCPYSADMYVQPVCPSYTVVGPSSVLTYASPPLITNVTTRSSATPAVGPPLEGPEHQAPLTYFPWPQPLSTLPTSTLQYQPPAPALPGPQFVQLPISIPEPVLQDMEDPRRAASSLTIDKLLLEEEDSDAYALNHTLSVEGF Predict reactive species\nFull Name: MultiPro® 5CFLX Anti-Human POU2AF1 (3C5A7)\nCalculated Molecular Weight: 256 aa, 27 kDa\nGenBank Accession Number: BC032549\nGene Symbol: POU2AF1\nGene ID (NCBI): 5450\nENSEMBL Gene ID: ENSG00000110777\nRRID: AB_3673958\nConjugate: 5CFLX\nFull Oligo Sequence: CGGAGATGTGTATAAGAGACAGGGTATCCGCAAGCGTCCCATATAAGAAA\nBarcode Sequence: GGTATCCGCAAGCGT\nForm: Liquid\nUNIPROT ID: Q16633\nStorage Buffer: PBS with 1mM EDTA and 0.09% sodium azide , pH 7.3.\nStorage Conditions: 2-8°C Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888299528361,"sku":"G66659-1-5C","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-g66659-1-5c","provider":"Iright","version":"1.0","type":"link"}