{"product_id":"proteintech-pe-fca98155","title":"Proteintech, PE-FcA98155, FcZero-rAb™ PE Anti-Mouse CD200R1 Rabbit Recombinant Antibody","description":"Size: 100ug\nThe CD200R1 (PE-FcA98155) by Proteintech is a Recombinant antibody targeting CD200R1 in FC applications with reactivity to mouse samples\nPE-FcA98155 targets CD200R1 in FC applications and shows reactivity with mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive FC detected in: MC\/9 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nFlow Cytometry (FC): FC : 0.1 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCell surface glycoprotein CD200 receptor 1 (CD200R1) is also called CD200R, CRTR2, MOX2R, and OX2R, and belongs to the CD200R family. CD200R1 is an inhibitory receptor for the CD200\/OX2 cell surface glycoprotein. CD200R1 is highly glycosylated, containing ten potential N-glycosylation sites (PMID: 15187158). CD200R1 limits inflammation by inhibiting the expression of pro-inflammatory molecules including TNF-alpha, interferons, and inducible nitric oxide synthase (iNOS) in response to selected stimuli. As an immune inhibitory molecule, CD200R1 binds to CD200, ultimately leading to the inhibition of classical activation of macrophages and microglia (PMID: 24588829).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Recombinant\nType: Antibody\nImmunogen: CatNo: Eg0988 Product name: Recombinant Mouse CD200R1 protein (His tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 26-238 aa of NM_021325.3 Sequence: TDKNQTTQNNSSSPLTQVNTTVSVQIGTKALLCCFSIPLTKAVLITWIIKLRGLPSCTIAYKVDTKTNETSCLGRNITWASTPDHSPELQISAVTLQHEGTYTCETVTPEGNFEKNYDLQVLVPPEVTYFPEKNRSAVCEAMAGKPAAQISWSPDGDCVTTSESHSNGTVTVRSTCHWEQNNVSDVSCIVSHLTGNQSLSIELSRGGNQSLRP Predict reactive species\nFull Name: CD200 receptor 1\nCalculated Molecular Weight: 36 kDa\nGenBank Accession Number: NM_021325.3\nGene Symbol: Cd200r1\nGene ID (NCBI): 57781\nConjugate: PE Fluorescent Dye\nExcitation\/Emission Maxima Wavelengths: 496 nm, 565 nm \/ 578 nm\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q9ES57\nStorage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.\nStorage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888628060329,"sku":"PE-FcA98155","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-pe-fca98155","provider":"Iright","version":"1.0","type":"link"}