Proteintech, 10207-2-AP, UBE2V1 Polyclonal antibody

Size: 20ul / 150ul The UBE2V1 (10207-2-AP) by Proteintech is a Polyclonal antibody targeting UBE2V1 in WB, ELISA applications with reactivity to human, mouse, rat samples 10207-2-AP targets UBE2V1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: BxPC-3 cells, HeLa cells, mouse brain tissue, mouse kidney tissue, rat brain tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information UBE2V1(Ubiquitin-conjugating enzyme E2 variant 1) is also named as CROC1, UBE2V, UEV1 and belongs to the ubiquitin-conjugating enzyme family. It has no ubiquitin ligase activity on its own and the UBE2V1-UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through Lys-63. CROC1 transcripts in all human tissues examined, with highest levels in brain, skeletal muscle, and kidney(PMID:9305758). It has 5 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0278 Product name: Recombinant human UBE2V1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 17-109 aa of BC000468 Sequence: LLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYPEAPPFVRFVTKINMNGVNSSNGVVDPRAISVLA Predict reactive species Full Name: ubiquitin-conjugating enzyme E2 variant 1 Calculated Molecular Weight: 20 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC000468 Gene Symbol: UBE2V1 Gene ID (NCBI): 7335 RRID: AB_2272560 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13404 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.