Proteintech, 10242-1-AP, CYC1 Polyclonal antibody

Size: 20ul / 150ul The CYC1 (10242-1-AP) by Proteintech is a Polyclonal antibody targeting CYC1 in WB, IHC, ELISA applications with reactivity to human, mouse samples 10242-1-AP targets CYC1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human brain tissue Positive IHC detected in: human liver cancer tissue, human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CYC1, also named as Cytochrome c-1, belongs to the cytochrome c family. Cytochrome c1 is one respiratory subunit of the 11 subunits of the cytochrome bc1 complex of the mitochondrial electron-transfer chain. It mediates the transfer of an electron from Rieske iron-sulfur protein to cytochrome c(PMID:3036122 ). CYC1 mediates apoptosis. In this pathway, a variety of apoptotic stimuli cause CYC1 release from mitochondria, which in turn induces a series of biochemical reactions that result incaspase activation and subsequent cell death.(PMID:15189137) While CYC1 release and DNA fragmentation are unaffected by the noncleavablep75 mutant, mitochondrial morphology of dying cells is maintained, and loss of plasma membrane integrity is delayed(PMID:15186778). The protein migrated as a 35 kd band in SDS page. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat, pig, monkey Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0291 Product name: Recombinant human CYC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 46-271 aa of BC001006 Sequence: ALSSKSGLSRGRKVMLSALGMLAAGGAGLAVALHSAVSASDLELHPPSYPWSHRGLLSSLDHTSIRRGFQVYKQVCASCHSMDFVAYRHLVGVCYTEDEAKELAAEVEVQDGPNEDGEMFMRPGKLFDYFPKPYPNSEAARAANNGALPPDLSYIVRARHGGEDYVFSLLTGYCEPPTGVSLREGLYFNPYFPGQAIAMAPPIYTDVLEFDDGTPATMSQIAKDVC Predict reactive species Full Name: cytochrome c-1 Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC001006 Gene Symbol: CYC1 Gene ID (NCBI): 1537 RRID: AB_2090144 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P08574 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.