Proteintech, 10263-1-AP, PIR Polyclonal antibody

Size: 20ul / 150ul The PIR (10263-1-AP) by Proteintech is a Polyclonal antibody targeting PIR in WB, IHC, IP, ELISA applications with reactivity to human samples 10263-1-AP targets PIR in WB, IHC, IP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, HeLa cells Positive IP detected in: HeLa cells Positive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Pirin (iron-binding nuclear protein, PIR) is a highly conserved 32-kDa protein consisting of 290 amino acids. Pirin mRNA is expressed weakly in all human tissues. Confocal immunofluorescence experiments demonstrate a predominant localization of Pirin within dot-like subnuclear structures. Pirin interacts with the oncoprotein B-cell lymphoma 3-encoded (Bcl-3) and nuclear factor I (NFI). Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0330 Product name: Recombinant human PIR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 46-230 aa of BC002517 Sequence: KGGRPGGFPDHPHRGFETVSYLLEGGSMAHEDFCGHTGKMNPGDLQWMTAGRGILHAEMPCSEEPAHGLQLWVNLRSSEKMVEPQYQELKSEEIPKPSKDGVTVAVISGEALGIKSKVYTRTPTLYLDFKLDPGAKHSQPIPKGWTSFIYTISGDVYIGPDDAQQKIEPHHTAVLGEGDSVQVEN Predict reactive species Full Name: pirin (iron-binding nuclear protein) Calculated Molecular Weight: 32 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC002517 Gene Symbol: PIR Gene ID (NCBI): 8544 RRID: AB_2283879 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O00625 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.