Proteintech, 10291-1-AP, EIF6 Polyclonal antibody

Size: 20ul / 150ul The EIF6 (10291-1-AP) by Proteintech is a Polyclonal antibody targeting EIF6 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 10291-1-AP targets EIF6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A375 cells, HeLa cells, mouse liver tissue, COLO 320 cells, HepG2 cells Positive IHC detected in: human prostate cancer tissue, human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Immunohistochemistry (IHC): IHC : 1:20-1:200 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information p27(BBP/eIF6) is an evolutionarily conserved protein that was originally identified as p27(BBP), It functions as an interactor of the cytoplasmic domain of integrin 4 and as the putative translation initiation factor eIF6. p27BBP is found in two pools: one nuclear pool enriched in the perinucleolar region, and one cytoplasmic pool. p27BBP binds to the fibronectin type III domains of integrin 4 subunit (ITGB4), an important functional component of hemidesmosomes, and help link ITGB4 to the intermediate filament cytoskeleton. In vitro and in vivo studies demonstrated that p27BBP is essential for cell viability and has a primary function in the biogenesis of the 60S ribosomal subunit. p27BBP protein is increased in rapidly cycling cells and decreased in villous cells committed to apoptotic cell death. In dysplastic colorectal adenomas and carcinomas, p27BBP displayed a large increase of its nucleolar component and was associated with the nuclear matrix. In particular, p27BBP increased progressively from adenomas to carcinomas and was related to the tumor stage. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0324 Product name: Recombinant human EIF6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-245 aa of BC001119 Sequence: MAVRASFENNCEIGCFAKLTNTYCLVAIGGSENFYSVFEGELSDTIPVVHASIAGCRIIGRMCVGNRHGLLVPNNTTDQELQHIRNSLPDTVQIRRVEERLSALGNVTTCNDYVALVHPDLDRETEEILADVLKVEVFRQTVADQVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIAAGMVVNDWCAFCGLDTTSTELSVVESVFKLNEAQPSTIATSMRDSLIDSLT Predict reactive species Full Name: eukaryotic translation initiation factor 6 Calculated Molecular Weight: 27 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC001119 Gene Symbol: EIF6 Gene ID (NCBI): 3692 RRID: AB_2096515 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P56537 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.