Proteintech, 10321-1-AP, PPP2R4 Polyclonal antibody

Size: 20ul / 150ul The PPP2R4 (10321-1-AP) by Proteintech is a Polyclonal antibody targeting PPP2R4 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 10321-1-AP targets PPP2R4 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HeLa cells, HepG2 cells, Jurkat cells, K-562 cells Positive IHC detected in: mouse testis tissue, mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0392 Product name: Recombinant human PP2A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 52-230 aa of BC002545 Sequence: ILTLNEGVKGKKLTFEYRVSEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLKESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVWGLDDFQFLPFIWGSSQLIDH Predict reactive species Full Name: protein phosphatase 2A activator, regulatory subunit 4 Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC002545 Gene Symbol: PPP2R4 Gene ID (NCBI): 5524 RRID: AB_2284352 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q15257 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.