Proteintech, 10329-1-AP, SUMO1 Polyclonal antibody

Size: 20ul / 150ul The SUMO1 (10329-1-AP) by Proteintech is a Polyclonal antibody targeting SUMO1 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples 10329-1-AP targets SUMO1 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, NIH/3T3 cells, PC-12 cells Positive IP detected in: HeLa cells Positive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Positive FC (Intra) detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Small ubiquitin-related modifier 1 (SUMO1) belongs to the ubiquitin family and the SUMO subfamily as it contains 1 ubiquitin-like domain and is also 18% identical to ubiquitin (PMID: 9654451).1. What is the molecular weight of SUMO1?The molecular weight of SUMO1 is 12 kDa.2. What is the cellular localization of SUMO1?SUMO1 is located in the nuclear membrane and is recruited by BCL11A to the nuclear body (PMID: 18681895).3. What modifications is SUMO1 subjected to?SUMO1 function occurs after the cleavage of its precursor form by SENP1 or SENP2 (PMID: 27576863). Polymeric SUMO1 chains also undergo polyubiquitination by RNF4 (PMID: 18408734).4. What is the function of SUMO1?SUMO1 post-translationally modifies many proteins that have roles in an array of processes including transcriptional regulation, chromatin structure, and DNA repair. SUMO1 can covalently attach itself to protein as a monomer or a lysine-linked polymer via an isopeptide bond (PMID:11124955). This SUMO modification can regulate the localization and activity of the affected proteins.5. What is SUMO1's involvement in disease?Defects in SUMO1 as a result of a chromosomal translocation are associated with non-syndromic orofacial cleft type 10, or non-syndromic cleft lip, and are associated with cleft palate in two-thirds of cases (PMID: 18983974). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0414 Product name: Recombinant human SUMO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC006462 Sequence: MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV Predict reactive species Full Name: SMT3 suppressor of mif two 3 homolog 1 (S. cerevisiae) Calculated Molecular Weight: 12 kDa Observed Molecular Weight: 12~18 kDa, 80-90 kDa GenBank Accession Number: BC006462 Gene Symbol: SUMO1 Gene ID (NCBI): 7341 RRID: AB_2286872 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P63165 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.