Proteintech, 10331-1-AP, RARA Polyclonal antibody

Size: 20ul / 150ul The RARA (10331-1-AP) by Proteintech is a Polyclonal antibody targeting RARA in WB, ELISA applications with reactivity to human, mouse, rat samples 10331-1-AP targets RARA in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A549 cells, MCF-7 cells, MDA-MB-231 cells, NIH/3T3 cells, T-47D cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information Retinoic acid receptors (RARs) function as nuclear receptors that control gene expression in response to binding of the ligand retinoic acid (RA). Retinoic acid receptor alpha (RARα), also known as NR1B1 (nuclear receptor subfamily 1, group B, member 1), plays an essential role in the regulation of retinoic acid-induced germ cell development during spermatogenesis. Formation of a complex with histone deacetylases might lead to inhibition of RARE DNA element binding and to transcriptional repression (PubMed:28167758). Transcriptional activation and RARE DNA element binding might be supported by the transcription factor KLF2 (PubMed:28167758). Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0420 Product name: Recombinant human RARA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 80-421 aa of BC008727 Sequence: PLPRIYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFPALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGLD Predict reactive species Full Name: retinoic acid receptor, alpha Calculated Molecular Weight: 51 kDa Observed Molecular Weight: 50-60 kDa GenBank Accession Number: BC008727 Gene Symbol: RARA Gene ID (NCBI): 5914 RRID: AB_2177742 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10276 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.