Proteintech, 10421-1-AP, CEA/CD66e Polyclonal antibody

Size: 20ul / 150ul The CEA/CD66e (10421-1-AP) by Proteintech is a Polyclonal antibody targeting CEA/CD66e in WB, IHC, IF-P, ELISA applications with reactivity to human samples 10421-1-AP targets CEA/CD66e in WB, IHC, IF-P, chIP, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HT-29 cells, MCF-7 cells, human saliva Positive IHC detected in: human colon cancer tissue, human appendicitis tissue, human stomach cancer tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human colon cancer tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information Carcinoembryonic antigen (CEA), also known as CEACAM5 or CD66e, is a cell surface glycoprotein belonging to the immunoglobulin superfamily, mainly serving as a cell adhesion molecule mediating intercellular contact by both homophilic and heterophilic binding (PMID: 21731662). CEA inhibits anoikis and plays a role in tumorigenesis and metastasis. CEA has been found to be overexpressed in a wide variety of human cancers, including colon, breast, and lung (PMID: 17167768). CEA is a tumor marker and is routinely exploited for diagnosis. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0672 Product name: Recombinant human CEACAM5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC034671 Sequence: MESPSAPPHRWCIPWQRLLLTASLLTFWNPPTTAKLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDSASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQ Predict reactive species Full Name: carcinoembryonic antigen-related cell adhesion molecule 5 Calculated Molecular Weight: 77 kDa Observed Molecular Weight: 180-200 kDa, 77 kDa GenBank Accession Number: BC034671 Gene Symbol: CEA Gene ID (NCBI): 1048 RRID: AB_2244691 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P06731 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.