Proteintech, 10427-2-AP, Calnexin Polyclonal antibody

Size: 20ul / 150ul The Calnexin (10427-2-AP) by Proteintech is a Polyclonal antibody targeting Calnexin in WB, IHC, IF/ICC, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 10427-2-AP targets Calnexin in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, HeLa cells, K-562 cells, MCF-7 cells, NIH/3T3 cells, U2OS cells, RAW 264.7 cells Positive IHC detected in: human breast cancer tissue, human cervical cancer tissue, human normal colonNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells, HepG2 cells, SKOV-3 cells Positive FC (Intra) detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information Calnexin is a molecular chaperone that resides in the endoplasmic reticulum (ER) and participates in the folding and assembly of newly synthesized proteins. Calnexin is highly abundant in ER and is frequently used as an ER marker. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat, pig, monkey, hamster, goat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0697 Product name: Recombinant human Calnexin protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-273 aa of BC003552 Sequence: MEGKWLLCMLLVLGTAIVEAHDGHDDDVIDIEDDLDDVIEEVEDSKPDTTAPPSSPKVTYKAPVPTGEVYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPS Predict reactive species Full Name: calnexin Calculated Molecular Weight: 90 kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: BC003552 Gene Symbol: Calnexin Gene ID (NCBI): 821 RRID: AB_2069033 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P27824 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.