Proteintech, 10441-1-AP, TORC1/CRTC1 Polyclonal antibody

Size: 20ul / 150ul The TORC1/CRTC1 (10441-1-AP) by Proteintech is a Polyclonal antibody targeting TORC1/CRTC1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 10441-1-AP targets TORC1/CRTC1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: mouse kidney tissue, A431 cells, Jurkat cells, L02 cells, mouse brain tissue Positive IP detected in: mouse kidney tissue Positive IHC detected in: human colon cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information CRTC1, also named as MECT1,TORC1, and WAMTP1, belongs to the TORC family. It is a transcriptional coactivator for CREB1 which activates transcription through both consensus and variant cAMP response element (CRE) sites. CRTC1 acts as a coactivator, in the SIK/TORC signaling pathway, being active when dephosphorylated and acts independently of CREB1 'Ser-133' phosphorylation. It enhances the interaction of CREB1 with TAF4. CRTC1 regulates the expression of specific CREB-activated genes such as the steroidogenic gene, StAR. It is a potent coactivator of PGC1alpha and inducer of mitochondrial biogenesis in muscle cells. CRTC1 is also a coactivator for TAX activation of the human T-cell leukemia virus type 1 (HTLV-1) long terminal repeats (LTR). In the hippocampus, CRTC1 involved in late-phase long-term potentiation (L-LTP) maintenance at the Schaffer collateral-CA1 synapses. It may be required for dendritic growth of developing cortical neurons. This is a rabbit polyclonal antibody raised against residues near N terminus of human CRTC1. CRTC1 has some isoforms produced by alternative splicing with MW of 67 kDa, 68 kDa and 62 kDa. Sometimes it appears as a 75-80 kDa band probably due to phosphorylation (PMID: 17183642; 22770221) Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0693 Product name: Recombinant human TORC1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC028050 Sequence: MATSNNPRKFSEKIALHNQKQAEETAAFEEVMKDLSLTRAARLQLQKSQYLQLGPSRGQYYGGSLPNVNQIGSGTMDLPFQTPFQSSGLDTSRTTRHHGLVDRVYRERGRLGSPHRRPLSVDKHGRQADSCPYGTMYLSPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRVLLLTVPGMEETTSEADKNLSKQAWDTKKTGSRPKSCEVPGINIFPSADQENTTALIPATHNTGGSLPDLTNIHFPSPLPTPLDPEEPTFPALSSSSSTGNLAANLTHLGIGGAGQGMSTP Predict reactive species Full Name: CREB regulated transcription coactivator 1 Calculated Molecular Weight: 75 kDa Observed Molecular Weight: 68-80 kDa GenBank Accession Number: BC028050 Gene Symbol: CRTC1 Gene ID (NCBI): 23373 RRID: AB_2083835 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q6UUV9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.