Proteintech, 10444-1-AP, SLC43A1 Polyclonal antibody

Size: 20ul / 150ul The SLC43A1 (10444-1-AP) by Proteintech is a Polyclonal antibody targeting SLC43A1 in WB, IHC, ELISA applications with reactivity to human samples 10444-1-AP targets SLC43A1 in WB, IHC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: PC-3 cells, Daudi cells Positive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information SLC43A1, also named as LAT3, PB39 and POV1, belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids. It plays a role in the development of human prostate cancer, from prostatic intraepithelial neoplasia to invasive prostate cancer. Specification Tested Reactivity: human Cited Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0305 Product name: Recombinant human SLC43A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 107-320 aa of BC001639 Sequence: RLVGSACFTASCTLMALASRDVEALSPLIFLALSLNGFGGICLTFTSLTLPNMFGNLRSTLMALMIGSYASSAITFPGIKLIYDAGVAFVVIMFTWSGLACLIFLNCTLNWPIEAFPAPEEVNYTKKIKLSGLALDHKVTGDLFYTHVTTMGQRLSQKAPSLEDGSDAFMSPQDVRGTSENLPERSVPLRKSLCSPTFLWSLLTMGMTQLRIIF Predict reactive species Full Name: solute carrier family 43, member 1 Calculated Molecular Weight: 61 kDa Observed Molecular Weight: 55-61 kDa GenBank Accession Number: BC001639 Gene Symbol: SLC43A1 Gene ID (NCBI): 8501 RRID: AB_2302076 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O75387 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.