Proteintech, 10468-1-AP, CXCL14 Polyclonal antibody

Size: 20ul / 150ul The CXCL14 (10468-1-AP) by Proteintech is a Polyclonal antibody targeting CXCL14 in IHC, IF/ICC, ELISA applications with reactivity to human samples 10468-1-AP targets CXCL14 in IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive IHC detected in: human liver tissue, human breast cancer tissue, human colon cancer tissue, human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CXCL 14 (C-X-C motif chemokine 14) is a small inducible cytokine, and may be a potent chemoattractant for neutrophils. CXCL14 possesses a destruction box (D-box) domain which acts as a recognition signal for degradation via the ubiquitin-proteasome pathway. CXCL14 is widely expressed in normal tissues including heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas without inflammatory stimuli. It is dispensable for dendritic cell function and localization within peripheral tissues. In localized prostate cancer, CXCL14 mRNA was significantly upregulated and positively correlated with Gleason score. Specification Tested Reactivity: human Cited Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0747 Product name: Recombinant human CXCL14 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-111 aa of BC003513 Sequence: MSLLPRRAPPVSMRLLAAALLLLLLALYTARVDGSKCKCSRKGPKIRYSDVKKLEMKPKYPHCEEKMVIITTKSVSRYRGQEHCLHPKLQSTKRFIKWYNAWNEKRRVYEE Predict reactive species Full Name: chemokine (C-X-C motif) ligand 14 Calculated Molecular Weight: 13 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: BC003513 Gene Symbol: CXCL14 Gene ID (NCBI): 9547 RRID: AB_2086070 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: O95715 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.