Proteintech, 10513-1-AP, MCM2 Polyclonal antibody

Size: 20ul / 150ul The MCM2 (10513-1-AP) by Proteintech is a Polyclonal antibody targeting MCM2 in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA applications with reactivity to human, mouse samples 10513-1-AP targets MCM2 in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, RIP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HCT 116 cells, HEK-293 cells, HeLa cells, K-562 cells Positive IP detected in: HEK-293 cells Positive IHC detected in: human tonsillitis tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human gliomas tissue Positive IF/ICC detected in: HeLa cells Positive FC (Intra) detected in: NIH/3T3 cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension Background Information The MCM2-7 complex forms the core of the replicative helicase which acts as the molecular motor that uses ATP binding and hydrolysis to fuel the unwinding of double-stranded DNA at the replication fork in eukaryotes. This complex is the putative replicative helicase essential for 'once per cell cycle' DNA replication initiation and elongation in eukaryotic cells. MCM2, also named CDCL1 and BM28, is a human nuclear protein that plays an important role in 2 crucial steps of the cell cycle, namely, onset of DNA replication and cell division. Specification Tested Reactivity: human, mouse Cited Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0798 Product name: Recombinant human MCM2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 657-904 aa of BC007670 Sequence: FDILCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKEEEGLANGSAAEPAMPNTYGVEPLPQEVLKKYIIYAKERVHPKLNQMDQDKVAKMYSDLRKESMATGSIPITVRHIESMIRMAEAHARIHLRDYVIEDDVNMAIRVMLESFIDTQKFSVMRSMRKTFARYLSFRRDNNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNLSAFYDSELFRMNKFSHDLKRKMILQQF Predict reactive species Full Name: minichromosome maintenance complex component 2 Calculated Molecular Weight: 102 kDa Observed Molecular Weight: 116-125 kDa GenBank Accession Number: BC007670 Gene Symbol: MCM2 Gene ID (NCBI): 4171 RRID: AB_2142131 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P49736 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.