Proteintech, 10554-1-AP, CD18 Polyclonal antibody

Size: 20ul / 150ul The CD18 (10554-1-AP) by Proteintech is a Polyclonal antibody targeting CD18 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human samples 10554-1-AP targets CD18 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: U-937 cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Positive IF/ICC detected in: THP-1 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CD18, also known as integrin beta-2, is a transmembrane protein that forms heterodimers with CD11a, CD11b, CD11c, CD11d (PMID: 1968349). CD11a/CD18 (LFA-1) is expressed by all leukocytes, while CD11b/CD18 (Mac-1) and CD11c/CD18 (p150,95) are normally restricted to expression on monocytes, macrophages, polymorphonuclear lymphocytes (PMNs), and natural killer cells (PMID: 1968349; 3109455; 10946284). CD18 plays an important role in mediating cell adhesion during immune response and defects of CD18 cause leukocyte adhesion deficiency (PMID: 3594570). Specification Tested Reactivity: human Cited Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag0861 Product name: Recombinant human CD18 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 469-769 aa of BC005861 Sequence: ICRCDTGYIGKNCECQTQGRSSQELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLIYGQYCECDTINCERYNGQVCGGPGRGLCFCGKCRCHPGFEGSACQCERTTEGCLNPRRVECSGRGRCRCNVCECHSGYQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAACPGLQLSNNPVKGRTCKERDSEGCWVAYTLEQQDGMDRYLIYVDESRECVAGPNIAAIVGGTVAGIVLIGILLLVIWKALIHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFAES Predict reactive species Full Name: integrin, beta 2 (complement component 3 receptor 3 and 4 subunit) Calculated Molecular Weight: 85 kDa Observed Molecular Weight: 85-90 kDa GenBank Accession Number: BC005861 Gene Symbol: CD18 Gene ID (NCBI): 3689 ENSEMBL Gene ID: ENSG00000160255 RRID: AB_2877736 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P05107 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.